THAP11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17677-100UL

Product Code. 18383804

Description

THAP11 Polyclonal antibody specifically detects THAP11 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: THAP11
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: CTG-B43a, CTG-B45d, HRIHFB2206, RONIN, THAP domain containing 11, THAP domain-containing protein 11
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF
• Quantity: 100 μg
• Research Discipline: Cancer, Stem Cell Markers
• Gene ID (Entrez): 57215
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified