missing translation for 'onlineSavingsMsg'
Learn More
Learn More
THAP11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17677-100UL
This item is not returnable.
View return policy
Description
THAP11 Polyclonal antibody specifically detects THAP11 in Human samples. It is validated for Immunofluorescence
Specifications
| THAP11 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| CTG-B43a, CTG-B45d, HRIHFB2206, RONIN, THAP domain containing 11, THAP domain-containing protein 11 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF | |
| 100 μg | |
| Cancer, Stem Cell Markers | |
| 57215 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido