missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TGF-beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Brand: Novus Biologicals NBP1-80289
This item is not returnable.
View return policy
Description
TGF-beta 1 Polyclonal specifically detects TGF-beta 1 in Human, Mouse, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TGF-beta 1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CEDLAP, DPD1, latency-associated peptide, TGFB, TGFbeta, TGF-beta 1 protein, TGF-beta-1, transforming growth factor beta-1, transforming growth factor, beta 1 | |
| Rabbit | |
| 43 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 5-10 ug/ml, Immunohistochemistry-Paraffin 5-10 ug/ml, Imaging Mass Cytometry | |
| NP_035707 | |
| TGFB1 | |
| Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. | |
| Affinity purified | |
| RUO | |
| 7040 | |
| Human, Mouse, Pig, Bovine, Canine, Canine, Equine, Guinea Pig, Goat, Sheep | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction