TFCP2L1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-10920-100UL

Product Code. 18348945

Description

TFCP2L1 Polyclonal specifically detects TFCP2L1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: TFCP2L1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: CRTR1CRTR-1, LBP-9, LBP9CP2-related transcriptional repressor 1, transcription factor CP2-like 1, transcription factor CP2-like protein 1, Transcription factor LBP-9
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2L1 (NP_055368). Peptide sequence LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL
• Quantity: 100 μg
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 29842
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified