missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TFCP2L1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93849-0.1ml
This item is not returnable.
View return policy
Description
TFCP2L1 Polyclonal antibody specifically detects TFCP2L1 in Human samples. It is validated for Western Blot
Specifications
| TFCP2L1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| CRTR1CRTR-1, LBP-9, LBP9CP2-related transcriptional repressor 1, transcription factor CP2-like 1, transcription factor CP2-like protein 1, Transcription factor LBP-9 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human TFCP2L1 (NP_055368.1). NAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIH | |
| 0.1 mL | |
| Transcription Factors and Regulators | |
| 29842 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction