missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TFCP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | TFCP2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunoprecipitation |
| Applications | Western Blot, Immunoprecipitation |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TFCP2 Polyclonal specifically detects TFCP2 in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| TFCP2 | |
| Western Blot, Immunoprecipitation | |
| Unconjugated | |
| Rabbit | |
| Human | |
| alpha-globin transcription factor CP2, CP2, LBP-1C, LSF1D, LSFLBP1C, SAA3 enhancer factor, SEF, TFCP2C, transcription factor CP2, Transcription factor LSF | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human TFCP2 (NP_005644). Peptide sequence YSMSDVLALPIFKQEESSLPPDNENKILPFQYVLCAATSPAVKLHDETLT | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunoprecipitation | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 7024 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title