missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TFB2M Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£470.00
Specifications
| Antigen | TFB2M |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TFB2M Polyclonal specifically detects TFB2M in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| TFB2M | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64216 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRFCILGSEAATRKHLPARNHCGLSDSSPQLWPEPDFRNPPRKASKASLDFKRYVTDRRLAETL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| dimethyladenosine transferase 2, mitochondrial, EC 2.1.1.-, FLJ22661, FLJ23182, HCV NS5A-transactivated protein 5, Hepatitis C virus NS5A-transactivated protein 5, Hkp1, h-mtTFB, h-mtTFB2, hTFB2M, Mitochondrial 12S rRNA dimethylase 2, Mitochondrial transcription factor B2, mtTFB2, NS5ATP5, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2, transcription factor B2, mitochondrial | |
| TFB2M | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title