missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Tetraspanin-4 Antibody - Azide and BSA Free, Novus Biologicals™

Tetraspanin-4 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. 18624271 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18624271 0.02 mL 0.02mL
18631701 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18624271 Supplier Novus Biologicals Supplier No. NBP2933650.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Tetraspanin-4 Polyclonal antibody specifically detects Tetraspanin-4 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Tetraspanin-4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000 - 1:5000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias Novel antigen 2, TETRASPAN, tetraspanin 4, tetraspanin-4, Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF, TSPAN-4
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human Tetraspanin-4 (NP_003262.1). IAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQE
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7106
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.