missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tetraspanin-31 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93191-0.02ml
This item is not returnable.
View return policy
Description
Tetraspanin-31 Polyclonal antibody specifically detects Tetraspanin-31 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Tetraspanin-31 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| sarcoma amplified sequence, Sarcoma-amplified sequence, SAStransmembrane 4 protein, tetraspanin 31, tetraspanin-31, tspan-31 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 95-175 of human TSPAN31 (NP_005972.1). SCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAICKSQSPTCQMCGEKFLKHSDEALKIL | |
| 0.02 mL | |
| Cell Cycle and Replication | |
| 6302 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction