missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TET3 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93429-0.1ml
This item is not returnable.
View return policy
Description
TET3 Polyclonal antibody specifically detects TET3 in Mouse samples. It is validated for Western Blot
Specifications
| TET3 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| EC 1.14.11.n2, hCG_40738, KIAA0401, methylcytosine dioxygenase TET3, MGC22014, probable methylcytosine dioxygenase TET3, tet oncogene family member 3 | |
| A synthetic peptide corresponding to a sequence within amino acids 1551-1650 of human TET3 (NP_001274420.1). GFQDKLWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDEN | |
| 0.1 mL | |
| Epigenetics | |
| 200424 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction