Testis expressed 264 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69517

Product Code. 18215303

Description

Testis expressed 264 Polyclonal specifically detects Testis expressed 264 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Testis expressed 264
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp451H0417, Putative secreted protein Zsig11, SIG11, testis expressed 264, testis expressed gene 264, testis expressed sequence 264, testis-expressed sequence 264 protein, ZSIG11FLJ13935
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y6I9
• Gene Symbols: TEX264
• Immunogen: Synthetic peptides corresponding to TEX264(testis expressed 264) The peptide sequence was selected from the middle region of TEX264. Peptide sequence SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51368
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only