missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TEN1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

TEN1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18371984 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18371984 25 μg 25µL
18037353 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18371984 Supplier Novus Biologicals Supplier No. NBP31012025UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TEN1 Polyclonal specifically detects TEN1 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TEN1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias C17orf106, CST complex subunit TEN1, FLJ39785, MGC54300, protein telomeric pathways with STN1 homolog, telomere length regulation protein TEN1 homolog, telomeric pathways in association with Stn1, number 1, TEN1 telomerase capping complex subunit homolog (S. cerevisiae)
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of Mouse TEN1 (NP_081383.1). Peptide sequence GSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFL
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 100134934
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.