missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP2-49189
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
TEM Polyclonal antibody specifically detects TEM in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spezifikation
| TEM | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| BRICD4, BRICHOS domain containing 4, CHM1L, chondromodulin-I-like protein, hChM1L, hTeM, myodulin, TEM, tendin, tenomodulin, UNQ771/PRO1565 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KHFWPEVPKKAYDMEHTFYSNGEKKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEF | |
| 0.1 mL | |
| Angiogenesis, Cardiovascular Biology | |
| 64102 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur