missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TEAD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TEAD4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TEAD4 Polyclonal specifically detects TEAD4 in Human, Mouse samples. It is validated for Western Blot.Specifications
| TEAD4 | |
| Polyclonal | |
| Rabbit | |
| NP_035697 | |
| 7004 | |
| Synthetic peptide towards Tead4. Peptide sequence RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3 | |
| TEAD4 | |
| IgG | |
| 48 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title