missing translation for 'onlineSavingsMsg'
Learn More

TEAD2 Antibody, Novus Biologicals™

Product Code. 18346373 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346373 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346373 Supplier Novus Biologicals Supplier No. NBP305267

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
View alternative products

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TEAD2 Polyclonal specifically detects TEAD2 in Human, Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TEAD2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias TEA domain family member 2TEF4ETF, TEAD-2, TEF-4, transcriptional enhancer factor TEF-4
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 217-280 of human TEAD2 (NP_003589.1). AWQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPE
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 8463
Target Species Human, Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.