missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TDAG8/GPR65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £484.00
Specifications
| Antigen | TDAG8/GPR65 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18206391
|
Novus Biologicals
NBP2-58485 |
100 μL |
£484.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18687978
|
Novus Biologicals
NBP2-58485-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TDAG8/GPR65 Polyclonal specifically detects TDAG8/GPR65 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TDAG8/GPR65 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, GPCR | |
| G protein-coupled receptor 65, G-protein coupled receptor 65, psychosine receptor, T-cell death-associated gene 8 protein, TDAG8hTDAG8 | |
| GPR65 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 8477 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title