missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCTEX1D4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TCTEX1D4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TCTEX1D4 Polyclonal specifically detects TCTEX1D4 in Human samples. It is validated for Western Blot.Specifications
| TCTEX1D4 | |
| Polyclonal | |
| Rabbit | |
| Tctex1 domain containing 4 | |
| TCTEX1D4 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 343521 | |
| Synthetic peptides corresponding to RP11-269F19.9 The peptide sequence was selected from the N terminal of RP11-269F19.9. Peptide sequence RGSMLGLAASFSRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title