missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCTA Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94682-0.1ml
This item is not returnable.
View return policy
Description
TCTA Polyclonal antibody specifically detects TCTA in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| TCTA | |
| Polyclonal | |
| Western Blot 1:200-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200 | |
| T-cell leukemia translocation altered gene, T-cell leukemia translocation-altered gene protein, T-cell leukemia translocation-associated gene protein | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human TCTA (NP_071503.1). MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRE | |
| 0.1 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 6988 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction