missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCP1-eta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | TCP1-eta |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
TCP1-eta Polyclonal specifically detects TCP1-eta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TCP1-eta | |
| Unconjugated | |
| RUO | |
| Q99832 | |
| 10574 | |
| Synthetic peptides corresponding to CCT7(chaperonin containing TCP1, subunit 7 (eta)) The peptide sequence was selected from the middle region of CCT7. Peptide sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| CCT-eta, CCTETA, CCTH, chaperonin containing TCP1, subunit 7 (eta), eta subunit, HIV-1 Nef interacting protein, HIV-1 Nef-interacting protein, MGC110985, Nip7-1, T-complex protein 1 subunit eta | |
| CCT7 | |
| IgG | |
| This product is specific to Subunit or Isoform: eta. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title