missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCP1 alpha Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | TCP1 alpha |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18401461
|
Novus Biologicals
NBP1-88149 |
0.1 mL |
£435.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18464801
|
Novus Biologicals
NBP1-88149-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TCP1 alpha Polyclonal antibody specifically detects TCP1 alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TCP1 alpha | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Hypoxia, Membrane Trafficking and Chaperones, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 6950 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CCT1T-complex protein 1 subunit alpha, CCTa, CCT-alpha, D6S230E, tailless complex polypeptide 1, t-complex 1, T-complex protein 1, alpha subunit, TCP-1-alpha | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title