missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TCP1 alpha Antibody, Novus Biologicals™

TCP1 alpha Antibody, Novus Biologicals™

Product Code. 18401461 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18401461 0.1 mL 0.10mL
18464801 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18401461 Supplier Novus Biologicals Supplier No. NBP188149

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TCP1 alpha Polyclonal antibody specifically detects TCP1 alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen TCP1 alpha
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias CCT1T-complex protein 1 subunit alpha, CCTa, CCT-alpha, D6S230E, tailless complex polypeptide 1, t-complex 1, T-complex protein 1, alpha subunit, TCP-1-alpha
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Hypoxia, Membrane Trafficking and Chaperones, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6950
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.