missing translation for 'onlineSavingsMsg'
Learn More

TCL1A Antibody (3G10), Novus Biologicals™

Product Code. 18330579 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18330579 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18330579 Supplier Novus Biologicals Supplier No. H00008115M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

TCL1A Monoclonal antibody specifically detects TCL1A in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen TCL1A
Applications Western Blot, ELISA
Classification Monoclonal
Clone 3G10
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_068801
Gene Alias Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, T-cell leukemia/lymphoma 1A, T-cell lymphoma-1, T-cell lymphoma-1A, TCL1T-cell leukemia/lymphoma protein 1A
Host Species Mouse
Immunogen TCL1A (NP_068801.1, 61 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 8115
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.