missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCFL5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17945-100UL
This item is not returnable.
View return policy
Description
TCFL5 Polyclonal antibody specifically detects TCFL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| TCFL5 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| bHLHe82, CHA, Cha transcription factor, CHAMGC46135, E2BP1, E2BP-1HPV-16 E2 binding protein 1, Figlb, HPV-16 E2-binding protein 1, transcription factor-like 5 (basic helix-loop-helix), transcription factor-like 5 protein | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA | |
| 100 μg | |
| Cell Cycle and Replication | |
| 10732 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction