TCFL5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17945-25UL

Product Code. 18309436

Description

TCFL5 Polyclonal antibody specifically detects TCFL5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TCFL5
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: bHLHe82, CHA, Cha transcription factor, CHAMGC46135, E2BP1, E2BP-1HPV-16 E2 binding protein 1, Figlb, HPV-16 E2-binding protein 1, transcription factor-like 5 (basic helix-loop-helix), transcription factor-like 5 protein
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTCPA
• Quantity: 25 μg
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10732
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified