TCF7L1/TCF3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-56055-25ul

Product Code. 18690299

Description

TCF7L1/TCF3 Polyclonal specifically detects TCF7L1/TCF3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TCF7L1/TCF3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: HMG box transcription factor 3, TCF3, TCF-3, transcription factor 7-like 1, transcription factor 7-like 1 (T-cell specific, HMG-box)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TCF7L1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKP
• Quantity: 25 μL
• Research Discipline: Core ESC Like Genes, Signal Transduction, Stem Cell Markers, Wnt Signaling Pathway
• Gene ID (Entrez): 83439
• Target Species: Human
• Isotype: IgG

For Research Use Only