missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCF19 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17794-25UL
This item is not returnable.
View return policy
Description
TCF19 Polyclonal antibody specifically detects TCF19 in Human samples. It is validated for Immunofluorescence
Specifications
| TCF19 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| SC1(TCF19)-6, SC1-1, SC1SC1(TCF19)-7, SCI(TCF19)-4, TCF-19, transcription factor 19, Transcription factor SC1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: TTPSAPPQRNRRKSVHRVLAELDDESEPPENPPPVLMEPRKKLRVDKAPLTPTGNRRGRPRKYP | |
| 25 μg | |
| Core ESC Like Genes, Stem Cell Markers | |
| 6941 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction