missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TCF-3/E2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38611-25ul
This item is not returnable.
View return policy
Description
TCF-3/E2A Polyclonal specifically detects TCF-3/E2A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| TCF-3/E2A | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P15923 | |
| TCF3 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS | |
| 25 μL | |
| Transcription Factors and Regulators | |
| 6929 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BHLHB21, bHLHb21TCF-3, Class B basic helix-loop-helix protein 21, E2A immunoglobulin enhancer-binding factor E12/E47, E2AKappa-E2-binding factor, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, ITF1Transcription factor ITF-1, MGC129647, MGC129648, Transcription factor 3, transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47), transcription factor E2-alpha, VDIR, VDR interacting repressor | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction