missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TCF-2/HNF-1 beta Monoclonal antibody specifically detects TCF-2/HNF-1 beta in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | TCF-2/HNF-1 beta |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 3E11 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_000449 |
| Gene Alias | FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic, LF-B3, variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1 |
| Host Species | Mouse |
| Immunogen | TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?