missing translation for 'onlineSavingsMsg'
Learn More

TCF-2/HNF-1 beta Antibody (3E11), Novus Biologicals™

Product Code. 18331849 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18331849 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18331849 Supplier Novus Biologicals Supplier No. H00006928M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

TCF-2/HNF-1 beta Monoclonal antibody specifically detects TCF-2/HNF-1 beta in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen TCF-2/HNF-1 beta
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 3E11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_000449
Gene Alias FJHN, hepatocyte nuclear factor 1-beta, HNF1 beta A, HNF1 homeobox B, HNF-1B, HNF1beta, HNF-1-beta, HNF2, Homeoprotein LFB3, LFB3, LF-B3, MODY5HPC11, TCF-2, TCF2transcription factor 2, hepatic, LF-B3, variant hepatic nuclear factor, Transcription factor 2, transcription factor 2, hepatic, Variant hepatic nuclear factor 1, vHNF1
Host Species Mouse
Immunogen TCF2 (NP_000449, 29 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Diabetes Research
Primary or Secondary Primary
Gene ID (Entrez) 6928
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.