TCERG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35474-20ul

Product Code. 30227625

Description

TCERG1 Polyclonal antibody specifically detects TCERG1 in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: TCERG1
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: CA150TATA box-binding protein-associated factor 2S, co-activator of 150 kDa, TAF2SMGC133200, TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD, TATA box-binding protein-associated factor 2S, transcription elongation regulator 1, Transcription factor CA150, Urn1
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TCERG1 (NP_006697.2).,, Sequence:, TTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKA
• Quantity: 20 μL
• Research Discipline: Cellular Markers, Transcription Factors and Regulators
• Gene ID (Entrez): 10915
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified