TCEB2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17944-100UL

Product Code. 18394174

Description

TCEB2 Polyclonal antibody specifically detects TCEB2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TCEB2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: 18-kD subunit, EloB, Elongin 18 kDa subunit, elongin-B, RNA polymerase II transcription factor SIII p18 subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B), transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B), transcription elongation factor B polypeptide 2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS
• Quantity: 100 μg
• Research Discipline: Cell Biology
• Gene ID (Entrez): 6923
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified