missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TCEB2 Polyclonal antibody specifically detects TCEB2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | TCEB2 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | 18-kD subunit, EloB, Elongin 18 kDa subunit, elongin-B, RNA polymerase II transcription factor SIII p18 subunit, RNA polymerase II transcription factor SIII subunit B, SIII p18, transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B), transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B), transcription elongation factor B polypeptide 2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?