missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TCEAL2 Polyclonal antibody specifically detects TCEAL2 in Mouse samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | TCEAL2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:2000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | my048, MY0876G05, TCEA-like protein 2, transcription elongation factor A (SII)-like 2, transcription elongation factor A protein-like 2, Transcription elongation factor S-II protein-like 2 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TCEAL2 (NP_525129.1). MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENTGKRVEEPLKDKEKPESAGKAKGEGKSERKGKSEMQGGSKTEGKPERGGRAEGEGEPDSER |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?