missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TC-1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£159.00 - £366.00
Specifications
| Antigen | TC-1 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693211
|
Novus Biologicals
NBP2-93727-0.02ml |
0.02 mL |
£159.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18675770
|
Novus Biologicals
NBP2-93727-0.1ml |
0.1 mL |
£366.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TC-1 Polyclonal antibody specifically detects TC-1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TC-1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Cancer, Cell Biology, Signal Transduction, Stem Cells | |
| PBS (pH 7.3), 50% glycerol | |
| 56892 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| chromosome 8 open reading frame 4, hTC-1, MGC22806, TC1 thyroid cancer-1, TC-1human thyroid cancer 1, Thyroid cancer protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human C8orf4 (NP_064515.1). MKAKRSHQAIIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title