missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TBRG4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58726
This item is not returnable.
View return policy
Description
TBRG4 Polyclonal specifically detects TBRG4 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| TBRG4 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| cell cycle progression 2 protein, Cell cycle progression protein 2, Cell cycle progression restoration protein 2, CPR2, FAST kinase domains 4, FASTKD4Cpr2, KIAA0948H_TD2522F11.8, protein TBRG4, transforming growth factor beta regulator 4FAST kinase domain-containing protein 4 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TBRG4 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FHQLLCLLNSQIASVWHGTLSKLLGSLYALGIPKASKELQSVEQEVRWRMRKLKYKHLAFLAESCATLSQEQHSQELLAELLTHLERRWTEIEDSHTLVTVMMKVG | |
| 100 μL | |
| Cell Cycle and Replication | |
| 9238 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction