TBR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-62728-25ul

Produktkod. 18647847

Beskrivning

TBR1 Polyclonal antibody specifically detects TBR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifikationer

• Antigen: TBR1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: MGC141978, T-box brain protein 1, T-box, brain, 1, TBR-1, T-brain-1, TES-56
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD
• Quantity: 25 μL
• Research Discipline: Neuroscience, Signal Transduction
• Gene ID (Entrez): 10716
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified