TBL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69369

Product Code. 18242892

Description

TBL2 Polyclonal specifically detects TBL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TBL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp434N024, DKFZP43N024, MGC134739, transducin (beta)-like 2, transducin beta-like protein 2, WBSCR13WS-betaTRPWS beta-transducin repeats protein, Williams-Beuren syndrome chromosomal region 13 protein, Williams-Beuren syndrome chromosome region 13
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 86%; Mouse: 85%, Rabbit: 86%.
• Target Species: Human, Mouse, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y4P3
• Gene Symbols: TBL2
• Immunogen: Synthetic peptides corresponding to TBL2(transducin (beta)-like 2) The peptide sequence was selected from the N terminal of TBL2. Peptide sequence RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26608
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only