missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tau tubulin kinase 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Tau tubulin kinase 2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Tau tubulin kinase 2 Polyclonal specifically detects Tau tubulin kinase 2 in Mouse samples. It is validated for Western Blot.Specifications
| Tau tubulin kinase 2 | |
| Polyclonal | |
| Rabbit | |
| NP_001020027 | |
| 146057 | |
| Synthetic peptide towards tau tubulin kinase 2. Peptide sequence KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.7.11, EC 2.7.11.1, KIAA0847tau-tubulin kinase 2, SCA11, spinocerebellar ataxia 11, tau tubulin kinase 2, TTBK | |
| TTBK2 | |
| IgG | |
| 137 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title