missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAO Kinase 1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33291-20ul
This item is not returnable.
View return policy
Description
TAO Kinase 1 Monoclonal antibody specifically detects TAO Kinase 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| TAO Kinase 1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| EC 2.7.11, FLJ14314, hKFC-B, KIAA1361STE20-like kinase PSK2, Kinase from chicken homolog B, MAP3K16EC 2.7.11.1, MARKKmicrotubule affinity regulating kinase kinase, PSK2serine/threonine kinase TAO1, serine/threonine-protein kinase TAO1, TAO kinase 1, TAO1serine/threonine protein kinase TAO1 homolog, Thousand and one amino acid protein 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAO Kinase 1 (NP_065842.1).,, Sequence:, FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS | |
| 20 μL | |
| GPCR, Protein Kinase | |
| 57551 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction