missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TAL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TAL2 Polyclonal specifically detects TAL2 in Human samples. It is validated for Western Blot.Specifications
| TAL2 | |
| Polyclonal | |
| Rabbit | |
| NP_005412 | |
| 6887 | |
| Synthetic peptide directed towards the N terminal of human TAL2. Peptide sequence TRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bHLHa19, Class A basic helix-loop-helix protein 19, TAL-2, T-cell acute lymphocytic leukemia 2, T-cell acute lymphocytic leukemia protein 2 | |
| TAL2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title