missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAK1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | TAK1L |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
TAK1L Polyclonal specifically detects TAK1L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TAK1L | |
| Polyclonal | |
| Purified | |
| RUO | |
| chromosome 21 open reading frame 7, HC21ORF7, putative gene, TGF-beta-activated kinase like10TAK1LTAK1-like protein, TAK1-like protein 1, TAK1-like protein 2, TAK1-like protein 4, TAKL, TAKL-1, TAKL-2, TAKL-4, TGF-beta activated kinase | |
| C21ORF7 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| P57077 | |
| 56911 | |
| Synthetic peptides corresponding to TAK1L The peptide sequence was selected from the C terminal of TAK1L. Peptide sequence DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title