TAF9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17443-25UL

Product Code. 18343575

Description

TAF9 Polyclonal antibody specifically detects TAF9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TAF9
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.7.4.3, MGC:5067, MGC1603, RNA polymerase II TBP-associated factor subunit G, STAF31/32, TAF2G, TAF9, TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa, TAFII31, TAFII-31, TAFII32, TAFII-32, TAFIID32, transcription initiation factor TFIID 31 kD subunit, Transcription initiation factor TFIID 31 kDa subunit, Transcription initiation factor TFIID 32 kDa subunit, transcription initiation factor TFIID subunit 9
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
• Quantity: 25 μg
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6880
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified