missing translation for 'onlineSavingsMsg'
Learn More

TAF5L Antibody, Novus Biologicals™

Product Code. 18398149 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18398149 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18398149 Supplier Novus Biologicals Supplier No. H00027097D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

TAF5L Polyclonal antibody specifically detects TAF5L in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TAF5L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. NP_001020418.1
Gene Alias PAF65BPAF65-beta, PCAF associated factor 65 beta, PCAF-associated factor 65 beta, TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDasubunit 5L, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65 kD, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associatedfactor, 65kDa
Host Species Rabbit
Immunogen TAF5L (NP_001020418.1, 1 a.a. - 325 a.a.) full-length human protein. MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27097
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.