missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TAF3B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TAF3B1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18349994 Alle ansehen Bio Techne Produkte
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μg
25 μg
missing translation for 'unitSize'
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18349994 100 μg 100µL
18399544 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18349994 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP317176100UL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

TAF3B1 Polyclonal antibody specifically detects TAF3B1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen TAF3B1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB, DKFZp686K0831, RNA polymerase III, GTF3B subunit 1, TAF3B1, TFIIIB150, TFIIIB90, TFNR, transcription factor-like nuclear regulator
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: YAINESQRPPDRSKMTMRDFIYYLPDNNPMTSSLEQEKKTEKPSTPVQTREQEGKSTPNAEDNEMEEETDDGPLLVPRVKVAEDGSII
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55814
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.