missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TAF11 Monoclonal antibody specifically detects TAF11 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), ELISA
Specifications
Specifications
| Antigen | TAF11 |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2G9 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_005634 |
| Gene Alias | 28kDa, TAF(II)28, TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2IMGC:15243, TAFII-28, TAFII28TFIID subunit p30-beta, TATA box binding protein (TBP)-associated factor, RNA polymerase II, I, 28kD, transcription initiation factor TFIID 28 kD subunit, Transcription initiation factor TFIID 28 kDa subunit, transcription initiation factor TFIID subunit 11 |
| Host Species | Mouse |
| Immunogen | TAF11 (NP_005634, 158 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIF |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?