missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18376579

TAF10 Antibody, Novus Biologicals™

Product Code. 18376579 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18376579 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18376579 Supplier Novus Biologicals Supplier No. H00006881D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TAF10 Polyclonal antibody specifically detects TAF10 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen TAF10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_006275.1
Gene Alias 30kDa, STAF28, TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, TAF2ATAFII-30, TAF2Htranscription initiation factor TFIID 30 kD subunit, TAFII30TAF(II)30, TATA box binding protein (TBP)-associated factor, RNA polymerase II, H, 30kD, Transcription initiation factor TFIID 30 kDa subunit, transcription initiation factor TFIID subunit 10
Host Species Rabbit
Immunogen TAF10 (NP_006275.1, 1 a.a. - 218 a.a.) full-length human protein. MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 6881
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.