TADA2L, Mouse anti-Human, Clone: 4A8-1A7, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00006871-M01.100ug

Product Code. 16151172

Description

Sequence: MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHRSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCTKTKEECEKHYMKYFINNPLFASTLLNLKQAEEAKTADTAIPFHSTDDPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHACRWFLSLEQYLCVYIYINRRDNGVFYVKFYK

Specifications

• Antigen: TADA2L
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: transcriptional adaptor 2 (ADA2 homolog, yeast)-like
• Gene Alias: ADA2/ADA2A/FLJ12705/KL04P/hADA2
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4A8-1A7
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: BC001172
• Gene Symbols: TADA2L
• Immunogen: TADA2L (AAH01172, 1 a.a. ∼ 305 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 6871
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ