TAB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-38625-100ul

Product Code. 30227709

Description

TAB2 Polyclonal antibody specifically detects TAB2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: TAB2
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA
• Gene Alias: FLJ21885, KIAA0733CHTD2, MAP3K7IP2mitogen-activated protein kinase kinase kinase 7 interacting protein 2, Mitogen-activated protein kinase kinase kinase 7-interacting protein 2, TAB-2, TAK1-binding protein 2, TGF-beta activated kinase 1/MAP3K7 binding protein 2, TGF-beta-activated kinase 1 and MAP3K7-binding protein 2, TGF-beta-activated kinase 1-binding protein 2
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 510-620 of human TAB2 (NP_055908.1).,, Sequence:, TLAHVDRISETRKLSMGSDDAAYTQALLVHQKARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNRQLQIDIDCLTKEIDLFQARG
• Quantity: 100 μL
• Research Discipline: Cytokine Research, Signal Transduction
• Gene ID (Entrez): 23118
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified