missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TAAR3 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10153-100UL
This item is not returnable.
View return policy
Description
TAAR3 Polyclonal specifically detects TAAR3 in Rat samples. It is validated for Western Blot.
Specifications
| TAAR3 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 493809 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the middle region of rat TAAR3 (NP_001008429.1). Peptide sequence GKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLD | |
| 100 μg | |
| Primary | |
| Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction