missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SZRD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SZRD1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
SZRD1 Polyclonal specifically detects SZRD1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SZRD1 | |
| Unconjugated | |
| RUO | |
| 26099 | |
| Synthetic peptides corresponding to C1orf144 (chromosome 1 open reading frame 144) The peptide sequence was selected from the N terminal of C1orf144)(50ug). Peptide sequence MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| C1orf144, chromosome 1 open reading frame 144, DKFZp566C0424, MGC70432, PM21, putative MAPK activating protein PM20, Putative MAPK-activating protein PM18/PM20/PM22 | |
| SZRD1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title