SYTL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17545-100UL

Codice prodotto. 18335284

Descrizione

SYTL4 Polyclonal antibody specifically detects SYTL4 in Human samples. It is validated for Immunofluorescence

Specifica

• Antigen: SYTL4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: DKFZp451P0116, exophilin-2, FLJ40960, Granuphilin, granuphilin-a, SLP4, synaptotagmin-like 4, synaptotagmin-like protein 4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIK
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 94121
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG