missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SYP Rabbit anti-Human, Polyclonal , Abnova™
Description
Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.[supplied by OMIM]
Sequence: DMDVVNQLVAGGQFRVVKEPLGFVKVLQWAAPSVL
Specifications
Specifications
| Antigen | SYP |
| Applications | Immunohistochemistry (PFA fixed), Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Description | Rabbit polyclonal antibody raised against recombinant human SYP. |
| Dilution | Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user. |
| Formulation | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Gene Symbols | SYP |
| Host Species | Rabbit |
| Immunogen | Recombinant protein corresponding to human SYP. |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?